Canonical class 1 structure of the human cortactin sh3 domain in complex with wip-derived peptide
PDB DOI: 10.2210/pdb9ezn/pdb
Classification: SIGNALING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2024-04-13 Deposition Author(s): Chill, J.H. , Sokolik, C.G.
Canonical class 1 structure of the human cortactin sh3 domain in complex with wip-derived peptide
Primary Citation of Related Structures: 9EZN
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
cDNA FLJ34459 fis, clone HLUNG2002916, highly similar to SRC SUBSTRATE CORTACTIN | A | 57 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ |
WAS/WASL-interacting protein family member 1 | B | 19 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | QRNRMPPPRPDVGSKPDSI |
Method: SOLUTION NMR
Deposited Date: 2024-04-13 Deposition Author(s): Chill, J.H. , Sokolik, C.G.