9EVR
Crystal structure of the kinetoplastid kinetochore protein kkt23 n-terminal domain from trypanosoma brucei
PDB DOI: 10.2210/pdb9evr/pdb
Classification: CELL CYCLE Organism(s): Trypanosoma Brucei Brucei Treu927
Deposited: 2024-04-01 Deposition Author(s): Akiyoshi, B. , Ishii, M. , Ludzia, P.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.7 Å
Crystal structure of the kinetoplastid kinetochore protein kkt23 n-terminal domain from trypanosoma brucei
Akiyoshi, B. , Ishii, M. , Ludzia, P.
Primary Citation of Related Structures: 9EVR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| N-acetyltransferase domain-containing protein | A | 71 | Trypanosoma Brucei Brucei Treu927 | GSLLSDEHLALLAKYYATVEFTGEQKDALIEKYWEANEAERKAIARAYASLFANDADFIQRLLAHYDMHVS |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2024-04-01 Deposition Author(s): Akiyoshi, B. , Ishii, M. , Ludzia, P.