Crystal structure of the kinetoplastid kinetochore protein kkt23 n-terminal domain from trypanosoma brucei
PDB DOI: 10.2210/pdb9evr/pdb
Classification: CELL CYCLE Organism(s): Trypanosoma Brucei Brucei Treu927
Deposited: 2024-04-01 Deposition Author(s): Akiyoshi, B. , Ishii, M. , Ludzia, P.
Crystal structure of the kinetoplastid kinetochore protein kkt23 n-terminal domain from trypanosoma brucei
Akiyoshi, B. , Ishii, M. , Ludzia, P.
Primary Citation of Related Structures: 9EVR
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
N-acetyltransferase domain-containing protein | A | 71 | Trypanosoma Brucei Brucei Treu927 | GSLLSDEHLALLAKYYATVEFTGEQKDALIEKYWEANEAERKAIARAYASLFANDADFIQRLLAHYDMHVS |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-04-01 Deposition Author(s): Akiyoshi, B. , Ishii, M. , Ludzia, P.