Backbone modification in the fungal defensin plectasin: d- and calpha-methyl-residues in the turns
PDB DOI: 10.2210/pdb9e3y/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): N.A.
Deposited: 2024-10-24 Deposition Author(s): Di, Y.P. , Gulewicz, A.J. , Harmon, T.W. , Horne, W.S. , Song, J.
Method: SOLUTION NMR Resolution: N.A.
Backbone modification in the fungal defensin plectasin: d- and calpha-methyl-residues in the turns
Di, Y.P. , Gulewicz, A.J. , Harmon, T.W. , Horne, W.S. , Song, J.
Primary Citation of Related Structures: 9E3Y
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Fungal defensin plectasin variant NZ2114 | A | 41 | N.A. | GFGCNGXWNEDDLRCHNHCKSIPPYKGGYCAKPGFVCKCYX |
Method: SOLUTION NMR
Deposited Date: 2024-10-24 Deposition Author(s): Di, Y.P. , Gulewicz, A.J. , Harmon, T.W. , Horne, W.S. , Song, J.