Backbone modification in the fungal defensin plectasin: prototype nz2114
PDB DOI: 10.2210/pdb9e3v/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): N.A.
Deposited: 2024-10-24 Deposition Author(s): Di, Y.P. , Gulewicz, A.J. , Harmon, T.W. , Horne, W.S. , Song, J.
Backbone modification in the fungal defensin plectasin: prototype nz2114
Di, Y.P. , Gulewicz, A.J. , Harmon, T.W. , Horne, W.S. , Song, J.
Primary Citation of Related Structures: 9E3V
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Fungal defensin plectasin variant NZ2114 | A | 41 | N.A. | GFGCNGPWNEDDLRCHNHCKSIKGYKGGYCAKGGFVCKCYX |
Method: SOLUTION NMR
Deposited Date: 2024-10-24 Deposition Author(s): Di, Y.P. , Gulewicz, A.J. , Harmon, T.W. , Horne, W.S. , Song, J.