Crystal structure of dephospho-coa kinase from klebsiella aerogenes (sulfate bound)
PDB DOI: 10.2210/pdb9dug/pdb
Classification: TRANSFERASE Organism(s): Klebsiella Aerogenes Kctc 2190
Deposited: 2024-10-02 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease , Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Crystal structure of dephospho-coa kinase from klebsiella aerogenes (sulfate bound)
Seattle Structural Genomics Center For Infectious Disease , Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Primary Citation of Related Structures: 9DUG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Dephospho-CoA kinase | A | 214 | Klebsiella Aerogenes Kctc 2190 | MAHHHHHHMTYTVALTGGIGSGKSTVADEFAHLGVTVIDADIIARQVVEPGTPALLAIAERFGPQMINDDGSLNRRRLRERIFAHSEDKAWLNALLHPLIQQETRRQMQASTSPYLLWVVPLLVENRLTDKADRILVVDVPKETQIERTIRRDGVSREHAEHILAAQATREQRLAAADDVIENMGSADAVASHVARLHDKYLMLASQAASQEKP |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-10-02 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease , Seattle Structural Genomics Center For Infectious Disease (Ssgcid)