Crystal structure of c3-threaded
PDB DOI: 10.2210/pdb9dea/pdb
Classification: DE NOVO PROTEIN Organism(s): Synthetic Construct
Deposited: 2024-08-28 Deposition Author(s): Baker, D. , Bera, A.K. , Sims, J.
Method: X-RAY DIFFRACTION Resolution: 2.87 Å
Crystal structure of c3-threaded
Baker, D. , Bera, A.K. , Sims, J.
Primary Citation of Related Structures: 9DEA
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| C3_threaded | A | 80 | Synthetic Construct | SALLEKIEKEAERLLDKDEAKLLILAEKFSGYAPACLLALVRQGADSLSLLIALEILLKVLTPENEPIILLGLKAILEKE |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-08-28 Deposition Author(s): Baker, D. , Bera, A.K. , Sims, J.