Solution structure of the translation initiation factor if-1 from neisseria gonorrhoeae (nccp11945). seattle structural genomics center for infectious disease target negoa.17902.a
PDB DOI: 10.2210/pdb9dcn/pdb
Classification: RNA BINDING PROTEIN Organism(s): Neisseria Gonorrhoeae (Strain Atcc 700825 / Fa 1090)
Deposited: 2024-08-27 Deposition Author(s): Buchko, G.W. , Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the translation initiation factor if-1 from neisseria gonorrhoeae (nccp11945). seattle structural genomics center for infectious disease target negoa.17902.a
Buchko, G.W. , Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Primary Citation of Related Structures: 9DCN
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Translation initiation factor IF-1 | A | 80 | Neisseria Gonorrhoeae (Strain Atcc 700825 / Fa 1090) | MAHHHHHHMAKEDTIQMQGEILETLPNATFKVKLENDHIVLGHISGKMRMHYIRISPGDKVTVELTPYDLTRARIVFRAR |
Method: SOLUTION NMR
Deposited Date: 2024-08-27 Deposition Author(s): Buchko, G.W. , Seattle Structural Genomics Center For Infectious Disease (Ssgcid)