Constrained b-hairpins targeting the epha4 ligand binding domain
PDB DOI: 10.2210/pdb9cy8/pdb
Classification: LIPID BINDING PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2024-08-01 Deposition Author(s): Assar, Z. , Baggio, C. , Muzzarelli, K.M. , Pellecchia, M. , Prentis, A.M.
Constrained b-hairpins targeting the epha4 ligand binding domain
Assar, Z. , Baggio, C. , Muzzarelli, K.M. , Pellecchia, M. , Prentis, A.M.
Primary Citation of Related Structures: 9CY8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ephrin type-A receptor 4 | A | 185 | Homo Sapiens , Synthetic Construct | GSHMNEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKAPLTVR |
| Constrained b-hairpin | B | 13 | Homo Sapiens , Synthetic Construct | XPYLVYRXEWSPX |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-08-01 Deposition Author(s): Assar, Z. , Baggio, C. , Muzzarelli, K.M. , Pellecchia, M. , Prentis, A.M.