Crystal structure of staphylococcal nuclease variant delta+phs v23r/l36d at cryogenic temperature
PDB DOI: 10.2210/pdb9cik/pdb
Classification: HYDROLASE Organism(s): Staphylococcus Aureus
Deposited: 2024-07-03 Deposition Author(s): Garcia-Moreno E., B. , Schlessman, J.L. , Siegler, M.A. , Zhang, Y.
Method: X-RAY DIFFRACTION Resolution: 1.95 Å
Crystal structure of staphylococcal nuclease variant delta+phs v23r/l36d at cryogenic temperature
Garcia-Moreno E., B. , Schlessman, J.L. , Siegler, M.A. , Zhang, Y.
Primary Citation of Related Structures: 9CIK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Thermonuclease | A | 143 | Staphylococcus Aureus | ATSTKKLHKEPATLIKAIDGDTRKLMYKGQPMTFRDLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSEDNADSGQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-07-03 Deposition Author(s): Garcia-Moreno E., B. , Schlessman, J.L. , Siegler, M.A. , Zhang, Y.