Crystal structure of mcl-1-peptide complex
PDB DOI: 10.2210/pdb9cdt/pdb
Classification: APOPTOSIS Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2024-06-25 Deposition Author(s): Bera, A.K. , Bhardwaj, G. , Kang, A. , Rettie, S.
Method: X-RAY DIFFRACTION Resolution: 2.1 Å
Crystal structure of mcl-1-peptide complex
Bera, A.K. , Bhardwaj, G. , Kang, A. , Rettie, S.
Primary Citation of Related Structures: 9CDT
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Induced myeloid leukemia cell differentiation protein Mcl-1 | A | 152 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVE |
MCB_D2 peptide | B | 16 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PPEIAWLADAVGLKDA |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-06-25 Deposition Author(s): Bera, A.K. , Bhardwaj, G. , Kang, A. , Rettie, S.