9C0O
Crystal structure of dmcfp1 phd finger bound to h3k4me3
PDB DOI: 10.2210/pdb9c0o/pdb
Classification: METAL BINDING PROTEIN Organism(s): Drosophila Melanogaster , Synthetic Construct
Deposited: 2024-05-27 Deposition Author(s): Couture, J.F. , Gregoire, S.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.53 Å
Crystal structure of dmcfp1 phd finger bound to h3k4me3
Primary Citation of Related Structures: 9C0O
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| CXXC-type zinc finger protein 1 | A | 66 | Drosophila Melanogaster , Synthetic Construct | GGKQEDQAYCICRSSDCSRFMIGCDGCEEWYHGDCIGITEKEAKHIKQYYCRRCKKENPELQTIFR |
| Histone H3.3C | D | 15 | Drosophila Melanogaster , Synthetic Construct | ARTKQTARKSTGGKY |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2024-05-27 Deposition Author(s): Couture, J.F. , Gregoire, S.