Ovsm from marinimicrobium koreense, an ovoselenol-biosynthetic n-methyltransferase in complex with sam
PDB DOI: 10.2210/pdb9bxj/pdb
Classification: TRANSFERASE Organism(s): Marinimicrobium Koreense
Deposited: 2024-05-22 Deposition Author(s): Davis, K.M. , Ireland, K.A.
Ovsm from marinimicrobium koreense, an ovoselenol-biosynthetic n-methyltransferase in complex with sam
Primary Citation of Related Structures: 9BXJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 5-selenohistidine N-methyltransferase OvsM | A | 267 | Marinimicrobium Koreense | MGSSHHHHHHSSGLVPRGSHMTDNPYETDELLGQYLDFHYGPGHFDVPNYPKACIEQALAHHTGTTGRALDLGCAVGRSSFELARRFDEVIGIDLSRRFIDSATRLAEQGQLQYQVTLEGELIERRTADLAALELSNTAGRTRFQVGDACALDDTLGRFDLIFAGNLIDRLPDPAAFLAQLPALVRPGGLLMITSPYTLLPEFTPRERWIGGFERNGQPVRMLDGLRHHLEPDFVLLEPTRDIPFVIRETTRKYQHTVAEASLWRRA |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-05-22 Deposition Author(s): Davis, K.M. , Ireland, K.A.