Crystal structure of bcl-xl in complex with a small molecule inhibitor
PDB DOI: 10.2210/pdb9aqz/pdb
Classification: APOPTOSIS Organism(s): Homo Sapiens
Deposited: 2024-02-22 Deposition Author(s): Judd, A.S. , Judge, R.A.
Crystal structure of bcl-xl in complex with a small molecule inhibitor
Primary Citation of Related Structures: 9AQZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bcl-2-like protein 1 | A | 167 | Homo Sapiens | MSQSNRELVVDFLSYKLSQKGYSASGGGGGGGMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKKMQVLVSRIAAWMATYLNDHLEPWIQENGGWATFVELYGNNAAAESRKGQERLEHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-02-22 Deposition Author(s): Judd, A.S. , Judge, R.A.