Crystal structure of lysb22-aspb28 insulin analog at ambient structure
PDB DOI: 10.2210/pdb8z4b/pdb
Classification: HORMONE Organism(s): Homo Sapiens
Deposited: 2024-04-17 Deposition Author(s): Ayan, E. , Demirci, H.
Method: X-RAY DIFFRACTION Resolution: 2.5 Å
Crystal structure of lysb22-aspb28 insulin analog at ambient structure
Primary Citation of Related Structures: 8Z4B
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Insulin A chain | A | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
| Insulin A chain | C | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
| Insulin B chain | B | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGEKGFFYTDKT |
| Insulin B chain | D | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGEKGFFYTDKT |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-04-17 Deposition Author(s): Ayan, E. , Demirci, H.