Crystal structure of caenorhabditis elegans him-8 zf1-2-ctd domain in complex with chromosome x pairing center
PDB DOI: 10.2210/pdb8yv9/pdb
Classification: DNA BINDING PROTEIN Organism(s): Human Herpesvirus 6B (Strain Hst) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2024-03-28 Deposition Author(s): Li, F.D. , Li, M.L.
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
C2H2-type domain-containing protein | A | 143 | Human Herpesvirus 6B (Strain Hst) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPHMMKSPDSKNDEINKDEIHNIQCHFPNCNRAIAWKRKYGKLRLIDHALVHCDKNFLKCKKCKHTCHTIRQMRYHYRIFHSTSKMEGFGVSGLPTKNKGFQKIMNACFADQLVEMNKRKNPPKSQNGSRRSRVKSKSKRSGI |
Method: X-RAY DIFFRACTION