PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

8YTH

Crystal structures of human irf2bp2 ring domain in complex with zbtb16 peptide

PDB DOI: 10.2210/pdb8yth/pdb

Classification: TRANSCRIPTION
Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2024-03-25
Deposition Author(s): Ding, J.P. , Wang, G.C.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 2.4 Å

Literature

Crystal structures of human irf2bp2 ring domain in complex with zbtb16 peptide

Ding, J.P. , Wang, G.C.

Primary Citation of Related Structures: 8YTH


Proteins
Molecule Chains Sequence Length Organism Sequence
Interferon regulatory factor 2-binding protein 2 A 83 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GSLATSAPLCCTLCHERLEDTHFVQCPSVPSHKFCFPCSRQSIKQQGASGEVYCPSGEKCPLVGSNVPWAFMQGEIATILAGD
Zinc finger and BTB domain-containing protein 16 B 8 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) RSSVITSA
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2024-03-25
Deposition Author(s): Ding, J.P. , Wang, G.C.