8YTG
Crystal structures of human irf2bp2 ring domain in complex with irf2 peptide
PDB DOI: 10.2210/pdb8ytg/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2024-03-25 Deposition Author(s): Ding, J.P. , Wang, G.C.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.45 Å
Crystal structures of human irf2bp2 ring domain in complex with irf2 peptide
Primary Citation of Related Structures: 8YTG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Interferon regulatory factor 2-binding protein 2 | A | 83 | Homo Sapiens , Synthetic Construct | GSLATSAPLCCTLCHERLEDTHFVQCPSVPSHKFCFPCSRQSIKQQGASGEVYCPSGEKCPLVGSNVPWAFMQGEIATILAGD |
| Interferon regulatory factor 2 | B | 8 | Homo Sapiens , Synthetic Construct | RASVIKKT |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2024-03-25 Deposition Author(s): Ding, J.P. , Wang, G.C.