Crystal structure of trka d5 domain in complex with macrocyclic peptide
PDB DOI: 10.2210/pdb8yte/pdb
Classification: TRANSFERASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2024-03-25 Deposition Author(s): Ando, A. , Mayumi, K. , Mihara, K. , Mikamiyama, H. , Nakata, Z. , Shimizu, M. , Ueda, T. , Yamada, T. , Yamauchi, D.
Crystal structure of trka d5 domain in complex with macrocyclic peptide
Ando, A. , Mayumi, K. , Mihara, K. , Mikamiyama, H. , Nakata, Z. , Shimizu, M. , Ueda, T. , Yamada, T. , Yamauchi, D.
Primary Citation of Related Structures: 8YTE
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
High affinity nerve growth factor receptor | A | 102 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | NVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIMAAFMDNP |
High affinity nerve growth factor receptor | C | 102 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | NVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIMAAFMDNP |
Macrocyclic Peptide | B | 14 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GFFLYPHGFYGIVC |
Macrocyclic Peptide | D | 14 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GFFLYPHGFYGIVC |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-03-25 Deposition Author(s): Ando, A. , Mayumi, K. , Mihara, K. , Mikamiyama, H. , Nakata, Z. , Shimizu, M. , Ueda, T. , Yamada, T. , Yamauchi, D.