Crystal structure of human dishevelled 2 (dvl2) pdz domain fused with wgef internal peptide motif
PDB DOI: 10.2210/pdb8yr7/pdb
Classification: SIGNALING PROTEIN Organism(s): Salmonella Enterica , Fremyella Diplosiphon
Deposited: 2024-03-20 Deposition Author(s): Kulkarni, K.A. , Mahajan, S. , Omble, A.
Crystal structure of human dishevelled 2 (dvl2) pdz domain fused with wgef internal peptide motif
Kulkarni, K.A. , Mahajan, S. , Omble, A.
Primary Citation of Related Structures: 8YR7
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Segment polarity protein dishevelled homolog DVL-2,Rho guanine nucleotide exchange factor 19 | A | 109 | Salmonella Enterica , Fremyella Diplosiphon | SMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKSGGGGSTFSLWQDIP |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-03-20 Deposition Author(s): Kulkarni, K.A. , Mahajan, S. , Omble, A.