Crystal structure of the small zinc-finger protein zifs (ttha0897) from thermus thermophilus hb8.
PDB DOI: 10.2210/pdb8yoz/pdb
Classification: UNKNOWN FUNCTION Organism(s): Thermus Thermophilus Hb8
Deposited: 2024-03-14 Deposition Author(s): Baba, S. , Fukui, K. , Kanai, Y. , Kumasaka, T. , Kurinami, S. , Masui, R. , Murakawa, T. , Okanishi, H. , Yano, T.
Method: X-RAY DIFFRACTION Resolution: 1.83 Å
Crystal structure of the small zinc-finger protein zifs (ttha0897) from thermus thermophilus hb8.
Baba, S. , Fukui, K. , Kanai, Y. , Kumasaka, T. , Kurinami, S. , Masui, R. , Murakawa, T. , Okanishi, H. , Yano, T.
Primary Citation of Related Structures: 8YOZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcription factor zinc-finger domain-containing protein | A | 82 | Thermus Thermophilus Hb8 | MPLLLCPNCQVGMREVERRGVLIDVCPQCGGVWLDKGELEKLLAEAEEVERRYEEELEGFYRKEGKPYKRKKGFMKLFDLFD |
| Transcription factor zinc-finger domain-containing protein | B | 82 | Thermus Thermophilus Hb8 | MPLLLCPNCQVGMREVERRGVLIDVCPQCGGVWLDKGELEKLLAEAEEVERRYEEELEGFYRKEGKPYKRKKGFMKLFDLFD |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-03-14 Deposition Author(s): Baba, S. , Fukui, K. , Kanai, Y. , Kumasaka, T. , Kurinami, S. , Masui, R. , Murakawa, T. , Okanishi, H. , Yano, T.