Structure of human palb2 coiled-coil domain
PDB DOI: 10.2210/pdb8yap/pdb
Classification: DNA BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2024-02-09 Deposition Author(s): Das, R. , Reddy, P.P.
Structure of human palb2 coiled-coil domain
Primary Citation of Related Structures: 8YAP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Partner and localizer of BRCA2 | A | 37 | Homo Sapiens | GKPLSCEEKEKLKEKLAFLKREYSKTLARLQRAQRAW |
| Partner and localizer of BRCA2 | B | 37 | Homo Sapiens | GKPLSCEEKEKLKEKLAFLKREYSKTLARLQRAQRAW |
Method: SOLUTION NMR
Deposited Date: 2024-02-09 Deposition Author(s): Das, R. , Reddy, P.P.