Crystal structure of phd domain of uhrf1 in complex with mstella peptide (residues 85-119)
PDB DOI: 10.2210/pdb8xv6/pdb
Classification: GENE REGULATION Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2024-01-14 Deposition Author(s): Du, X. , Gan, Q. , Liu, J. , Xu, J.
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
E3 ubiquitin-protein ligase UHRF1 | A | 75 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRNDA |
E3 ubiquitin-protein ligase UHRF1 | C | 75 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRNDA |
Developmental pluripotency-associated protein 3 | B | 35 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KRRVRTLLSVLKDPIAKMRRLVRIEQRQKRLEGNE |
Developmental pluripotency-associated protein 3 | D | 35 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KRRVRTLLSVLKDPIAKMRRLVRIEQRQKRLEGNE |
Method: X-RAY DIFFRACTION