Crystal structure of the chromodomain of arabidopsis lhp1 in complex with histone h3.3k27me3 peptide
PDB DOI: 10.2210/pdb8xag/pdb
Classification: GENE REGULATION Organism(s): Arabidopsis Thaliana , Synthetic Construct
Deposited: 2023-12-04 Deposition Author(s): Huang, Y. , Liu, Y.
Method: X-RAY DIFFRACTION Resolution: 1.75 Å
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Chromo domain-containing protein LHP1 | A | 66 | Arabidopsis Thaliana , Synthetic Construct | GSERPKLDEGFYEIEAIRRKRVRKGKVQYLIKWRGWPETANTWEPLENLQSIADVIDAFEGSLKPG |
Chromo domain-containing protein LHP1 | B | 66 | Arabidopsis Thaliana , Synthetic Construct | GSERPKLDEGFYEIEAIRRKRVRKGKVQYLIKWRGWPETANTWEPLENLQSIADVIDAFEGSLKPG |
histone H3.3K27me3 peptide | C | 8 | Arabidopsis Thaliana , Synthetic Construct | ARKSAPTT |
histone H3.3K27me3 peptide | D | 8 | Arabidopsis Thaliana , Synthetic Construct | ARKSAPTT |
Method: X-RAY DIFFRACTION