Solution structure of the cd28 hinge used in chimeric antigen receptor (car) t-cells
PDB DOI: 10.2210/pdb8w2v/pdb
Classification: IMMUNE SYSTEM Organism(s): Homo Sapiens
Deposited: 2024-02-21 Deposition Author(s): Chen, X. , Folimonova, V. , Walters, K.J.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the cd28 hinge used in chimeric antigen receptor (car) t-cells
Chen, X. , Folimonova, V. , Walters, K.J.
Primary Citation of Related Structures: 8W2V
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| T-cell-specific surface glycoprotein CD28 | A | 39 | Homo Sapiens | IEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP |
Method: SOLUTION NMR
Deposited Date: 2024-02-21 Deposition Author(s): Chen, X. , Folimonova, V. , Walters, K.J.