Solution structure of the cd28 hinge used in chimeric antigen receptor (car) t-cells
PDB DOI: 10.2210/pdb8w2v/pdb
Classification: IMMUNE SYSTEM Organism(s): Salmonella Enterica
Deposited: 2024-02-21 Deposition Author(s): Chen, X. , Folimonova, V. , Walters, K.J.
Solution structure of the cd28 hinge used in chimeric antigen receptor (car) t-cells
Chen, X. , Folimonova, V. , Walters, K.J.
Primary Citation of Related Structures: 8W2V
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
T-cell-specific surface glycoprotein CD28 | A | 39 | Salmonella Enterica | IEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP |
Method: SOLUTION NMR
Deposited Date: 2024-02-21 Deposition Author(s): Chen, X. , Folimonova, V. , Walters, K.J.