Co-crystal structure of aquifex aeolicus trbp111 in complex with e. coli trna-ile
PDB DOI: 10.2210/pdb8vu0/pdb
Classification: RNA BINDING PROTEIN/RNA Organism(s): Polysiphonia Urceolata , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2024-01-27 Deposition Author(s): Umuhire Juru, A. , Zhang, J.
Method: X-RAY DIFFRACTION Resolution: 2.64 Å
Co-crystal structure of aquifex aeolicus trbp111 in complex with e. coli trna-ile
Primary Citation of Related Structures: 8VU0
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Methionyl-tRNA synthetase beta subunit | B | 113 | Polysiphonia Urceolata , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPMEEKALIGIEDFLKVDLRVAKVLSAERVEGSEKLLKLTLSLGDEERTVVAGIAKYYTPEELVGKKIVIVANLKPRKIFGIESQGMILAASDGENLSVIVPDRDVKEGAKLS |
Methionyl-tRNA synthetase beta subunit | A | 113 | Polysiphonia Urceolata , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPMEEKALIGIEDFLKVDLRVAKVLSAERVEGSEKLLKLTLSLGDEERTVVAGIAKYYTPEELVGKKIVIVANLKPRKIFGIESQGMILAASDGENLSVIVPDRDVKEGAKLS |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-01-27 Deposition Author(s): Umuhire Juru, A. , Zhang, J.