Haddock models of human alpham i-domain bound to the the n-terminal domain of the cytokine pleiotrophin
PDB DOI: 10.2210/pdb8voh/pdb
Classification: CELL ADHESION Organism(s): Homo Sapiens
Deposited: 2024-01-15 Deposition Author(s): Nguyen, H. , Wang, X.
Method: SOLUTION NMR Resolution: N.A.
Haddock models of human alpham i-domain bound to the the n-terminal domain of the cytokine pleiotrophin
Primary Citation of Related Structures: 8VOH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Integrin alpha-M | A | 194 | Homo Sapiens | EDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEGTQT |
| Pleiotrophin | B | 58 | Homo Sapiens | GKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCN |
Method: SOLUTION NMR
Deposited Date: 2024-01-15 Deposition Author(s): Nguyen, H. , Wang, X.