8VLD
Crystal structure of ash1l phd finger in complex with histone h3k4me2
PDB DOI: 10.2210/pdb8vld/pdb
Classification: TRANSFERASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2024-01-11 Deposition Author(s): Kutateladze, T.G. , Vann, K.R.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.92 Å
Crystal structure of ash1l phd finger in complex with histone h3k4me2
Kutateladze, T.G. , Vann, K.R.
Primary Citation of Related Structures: 8VLD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Histone-lysine N-methyltransferase ASH1L | A | 56 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLDVIRCICGLYKDEGLMIQCDKCMVWQHCDCMGVNSDVEHYLCEQCDPRPVDRE |
| Histone-lysine N-methyltransferase ASH1L | B | 56 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLDVIRCICGLYKDEGLMIQCDKCMVWQHCDCMGVNSDVEHYLCEQCDPRPVDRE |
| Histone H3.3C | T | 11 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ARTKQTARKST |
| Histone H3.3C | P | 11 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ARTKQTARKST |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2024-01-11 Deposition Author(s): Kutateladze, T.G. , Vann, K.R.