Crystal structure of the transpeptidase domain of a s310a mutant of pbp2 from neisseria gonorrhoeae strain h041
PDB DOI: 10.2210/pdb8vbz/pdb
Classification: HYDROLASE Organism(s): Neisseria Gonorrhoeae
Deposited: 2023-12-13 Deposition Author(s): Bala, S. , Davies, C. , Stratton, C.
Crystal structure of the transpeptidase domain of a s310a mutant of pbp2 from neisseria gonorrhoeae strain h041
Bala, S. , Davies, C. , Stratton, C.
Primary Citation of Related Structures: 8VBZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Probable peptidoglycan D,D-transpeptidase PenA | A | 330 | Neisseria Gonorrhoeae | GSGGALSLDQRIQTLAYEELNKAVEYHQAKAGTVVVLDARTGEILALVNTPGRNRAVTDMIEPGAVMKPFPIAKALDSGKVDTTDTFNTLPYKIGPATVQDTHVYPTLDVRGIMQKSSNVGTSKLSAMFTPKEMYDFYHDLGVGVRMHSGFPGESAGVLRNWRKWRPIEQATMSFGYGLQLSLLQLARAYTVLTHDGELLPVSFEKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGSGIAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTANGYYSGVVTGPVFKQVMGGSLNILGVSPTKPLTNV |
Method: X-RAY DIFFRACTION
Deposited Date: 2023-12-13 Deposition Author(s): Bala, S. , Davies, C. , Stratton, C.