Carboxy terminus of oleate hydratase in phosphate buffer
PDB DOI: 10.2210/pdb8um2/pdb
Classification: LIPID TRANSPORT Organism(s): N.A.
Deposited: 2023-10-17 Deposition Author(s): Grace, C.R. , Radka, C.
Method: SOLUTION NMR Resolution: N.A.
Carboxy terminus of oleate hydratase in phosphate buffer
Primary Citation of Related Structures: 8UM2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Myosin-cross-reactive antigen | A | 42 | N.A. | NDHQDLREITKDSKMQKLALAGFLKKIKGTYIESLLKEHKLL |
Method: SOLUTION NMR
Deposited Date: 2023-10-17 Deposition Author(s): Grace, C.R. , Radka, C.