Structure of the carboxy terminus of oleate hydratase
PDB DOI: 10.2210/pdb8um1/pdb
Classification: LIPID TRANSPORT Organism(s): N.A.
Deposited: 2023-10-17 Deposition Author(s): Grace, C.R. , Radka, C.
Method: SOLUTION NMR Resolution: N.A.
Structure of the carboxy terminus of oleate hydratase
Primary Citation of Related Structures: 8UM1
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Myosin-cross-reactive antigen | A | 42 | N.A. | NDHQDLREITKDSKMQKLALAGFLKKIKGTYIESLLKEHKLL |
Method: SOLUTION NMR
Deposited Date: 2023-10-17 Deposition Author(s): Grace, C.R. , Radka, C.