Crystal structure of de novo designed metal-controlled heterodimer of mutant b1 immunoglobulin-binding domain of streptococcal protein g mchet_a + mchet_b
PDB DOI: 10.2210/pdb8ug0/pdb
Classification: DE NOVO PROTEIN Organism(s): Streptococcus Pyogenes
Deposited: 2023-10-05 Deposition Author(s): Huxford, T. , Maniaci, B. , Mealka, M. , Stec, B.
Crystal structure of de novo designed metal-controlled heterodimer of mutant b1 immunoglobulin-binding domain of streptococcal protein g mchet_a + mchet_b
Huxford, T. , Maniaci, B. , Mealka, M. , Stec, B.
Primary Citation of Related Structures: 8UG0
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Beta 1 domain of streptococcal protein G (G beta 1) MCHetA | A | 56 | Streptococcus Pyogenes | MTYKLILNGKTRKGVLTVEAVDAATAEKHFKQHANDLGVDGEWTYDDATKTFTVTE |
Beta 1 domain of streptococcal protein G (G beta 1) MCHetB | B | 56 | Streptococcus Pyogenes | MTYKLILNGKTHKGVLTVEAVDAATAEKEFKQEANDLGVDGEWTYDDATKTFTVTE |
Method: X-RAY DIFFRACTION
Deposited Date: 2023-10-05 Deposition Author(s): Huxford, T. , Maniaci, B. , Mealka, M. , Stec, B.