X-ray crystal structure of tebp-2 mcd3 with ds dna
PDB DOI: 10.2210/pdb8u8l/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Human Herpesvirus 6B (Strain Hst) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2023-09-18 Deposition Author(s): Nandakumar, J. , Padmanaban, S.
X-ray crystal structure of tebp-2 mcd3 with ds dna
Nandakumar, J. , Padmanaban, S.
Primary Citation of Related Structures: 8U8L
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Double-strand telomeric DNA-binding proteins 2 | A | 125 | Human Herpesvirus 6B (Strain Hst) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SKRIEKRTKFTVDDHVVAWKFIYEKLVEADKEGVQLMPKGIAFWNDFVRVTRSSKSATNWSSHFRKIMCPGLHEMPLHKKTILYLLKNIGIEIDKETEQIIERKFNVKLLVGIDRNLISYKLLDA |
Double-strand telomeric DNA-binding proteins 2 | B | 125 | Human Herpesvirus 6B (Strain Hst) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SKRIEKRTKFTVDDHVVAWKFIYEKLVEADKEGVQLMPKGIAFWNDFVRVTRSSKSATNWSSHFRKIMCPGLHEMPLHKKTILYLLKNIGIEIDKETEQIIERKFNVKLLVGIDRNLISYKLLDA |
Method: X-RAY DIFFRACTION
Deposited Date: 2023-09-18 Deposition Author(s): Nandakumar, J. , Padmanaban, S.