Solution structure of the phd6 finger of mll4 bound to tet3
PDB DOI: 10.2210/pdb8u2y/pdb
Classification: GENE REGULATION Organism(s): Salmonella Enterica
Deposited: 2023-09-06 Deposition Author(s): Kutateladze, T.G. , Mohid, S.A. , Zandian, M. , Zhang, Y.
Solution structure of the phd6 finger of mll4 bound to tet3
Kutateladze, T.G. , Mohid, S.A. , Zandian, M. , Zhang, Y.
Primary Citation of Related Structures: 8U2Y
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Methylcytosine dioxygenase TET3 | A | 9 | Salmonella Enterica | GVGGSWGVF |
Histone-lysine N-methyltransferase 2D | B | 60 | Salmonella Enterica | SLVTCPICHAPYVEEDLLIQCRHCERWMHAGCESLFTEDDVEQAADEGFDCVSCQPYVVK |
Method: SOLUTION NMR
Deposited Date: 2023-09-06 Deposition Author(s): Kutateladze, T.G. , Mohid, S.A. , Zandian, M. , Zhang, Y.