Nmr assignments and structure for the dimeric kinesin neck domain
PDB DOI: 10.2210/pdb8tt7/pdb
Classification: MOTOR PROTEIN Organism(s): Rattus Norvegicus
Deposited: 2023-08-12 Deposition Author(s): Alexandrescu, A.T.
Method: SOLUTION NMR Resolution: N.A.
Nmr assignments and structure for the dimeric kinesin neck domain
Primary Citation of Related Structures: 8TT7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Kinesin heavy chain isoform 5C | A | 54 | Rattus Norvegicus | GSKTIKNTVSVNLELTAEEWKKKYEKEKEKNKALKSVIQHLEVELNRWRNGEAV |
| Kinesin heavy chain isoform 5C | B | 54 | Rattus Norvegicus | GSKTIKNTVSVNLELTAEEWKKKYEKEKEKNKALKSVIQHLEVELNRWRNGEAV |
Method: SOLUTION NMR
Deposited Date: 2023-08-12 Deposition Author(s): Alexandrescu, A.T.