Crystal structure analysis of bcl11a in complex with dna
PDB DOI: 10.2210/pdb8tlo/pdb
Classification: TRANSCRIPTION Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2023-07-27 Deposition Author(s): Dhe-Paganon, S. , Seo, H.-S.
Crystal structure analysis of bcl11a in complex with dna
Primary Citation of Related Structures: 8TLO
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
B-cell lymphoma/leukemia 11A | A | 110 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPHMPGRPSSKEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTRHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDRVLNNDIKTE |
Method: X-RAY DIFFRACTION
Deposited Date: 2023-07-27 Deposition Author(s): Dhe-Paganon, S. , Seo, H.-S.