Structure of red beta c-terminal domain in complex with ssb c-terminal peptide, form 4
PDB DOI: 10.2210/pdb8tgc/pdb
Classification: DNA BINDING PROTEIN Organism(s): Sars-Cov-2 Pseudovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2023-07-12 Deposition Author(s): Bell, C.E.
Structure of red beta c-terminal domain in complex with ssb c-terminal peptide, form 4
Primary Citation of Related Structures: 8TGC
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Recombination protein bet | B | 84 | Sars-Cov-2 Pseudovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHMTAYTAERQPERDITPVNDETMQEINTLLIALDKTWDDDLLPLCSQIFRRDIRASSELTQAEAVKALGFLKQKAAEQKVAA |
Recombination protein bet | A | 84 | Sars-Cov-2 Pseudovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHMTAYTAERQPERDITPVNDETMQEINTLLIALDKTWDDDLLPLCSQIFRRDIRASSELTQAEAVKALGFLKQKAAEQKVAA |
Plasmid-derived single-stranded DNA-binding protein | C | 10 | Sars-Cov-2 Pseudovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | WMDFDDDIPF |
Plasmid-derived single-stranded DNA-binding protein | D | 10 | Sars-Cov-2 Pseudovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | WMDFDDDIPF |
Method: X-RAY DIFFRACTION
Deposited Date: 2023-07-12 Deposition Author(s): Bell, C.E.