Structure of red beta c-terminal domain in complex with ssb c-terminal peptide, form 4
PDB DOI: 10.2210/pdb8tgc/pdb
Classification: DNA BINDING PROTEIN Organism(s): Escherichia Phage Lambda , Synthetic Construct
Deposited: 2023-07-12 Deposition Author(s): Bell, C.E.
Structure of red beta c-terminal domain in complex with ssb c-terminal peptide, form 4
Primary Citation of Related Structures: 8TGC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Recombination protein bet | B | 84 | Escherichia Phage Lambda , Synthetic Construct | GSHMTAYTAERQPERDITPVNDETMQEINTLLIALDKTWDDDLLPLCSQIFRRDIRASSELTQAEAVKALGFLKQKAAEQKVAA |
| Recombination protein bet | A | 84 | Escherichia Phage Lambda , Synthetic Construct | GSHMTAYTAERQPERDITPVNDETMQEINTLLIALDKTWDDDLLPLCSQIFRRDIRASSELTQAEAVKALGFLKQKAAEQKVAA |
| Plasmid-derived single-stranded DNA-binding protein | C | 10 | Escherichia Phage Lambda , Synthetic Construct | WMDFDDDIPF |
| Plasmid-derived single-stranded DNA-binding protein | D | 10 | Escherichia Phage Lambda , Synthetic Construct | WMDFDDDIPF |
Method: X-RAY DIFFRACTION
Deposited Date: 2023-07-12 Deposition Author(s): Bell, C.E.