Rag2-phd finger in complex with h3k4tbunle peptide
PDB DOI: 10.2210/pdb8t4r/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2023-06-09 Deposition Author(s): Kean, K.M. , Travis, C.R. , Waters, M.L.
Rag2-phd finger in complex with h3k4tbunle peptide
Kean, K.M. , Travis, C.R. , Waters, M.L.
Primary Citation of Related Structures: 8T4R
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
V(D)J recombination-activating protein 2 | A | 108 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLAERTLIHLSAGSNKYYCNEHVEIARA |
H3 histone peptide | D | 14 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ARTXQTARKSTGGY |
Method: X-RAY DIFFRACTION
Deposited Date: 2023-06-09 Deposition Author(s): Kean, K.M. , Travis, C.R. , Waters, M.L.