Chimeric ets-domain of murine pu.1 harboring the corresponding beta-strand 3 (s3) residues from murine ets-1 in complex with d(aataagcggaagtggg)
PDB DOI: 10.2210/pdb8smh/pdb
Classification: TRANSCRIPTION Organism(s): Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2023-04-26 Deposition Author(s): Poon, G.M.K. , Terrell, J.R.
Method: X-RAY DIFFRACTION Resolution: 1.37 Å
Chimeric ets-domain of murine pu.1 harboring the corresponding beta-strand 3 (s3) residues from murine ets-1 in complex with d(aataagcggaagtggg)
Primary Citation of Related Structures: 8SMH
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transcription factor PU.1 | F | 107 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGIIHKTAKKKLTYQFSGEVLGRGGLAERRLPPH |
Method: X-RAY DIFFRACTION
Deposited Date: 2023-04-26 Deposition Author(s): Poon, G.M.K. , Terrell, J.R.