Structural and functional characterisation of tst2, a novel trpv1 inhibitory peptide from the australian sea anemone telmatactis stephensoni
PDB DOI: 10.2210/pdb8sem/pdb
Classification: TOXIN Organism(s): Telmatactis Stephensoni
Deposited: 2023-04-10 Deposition Author(s): Elnahriry, K.A. , Norton, R.S. , Wai, D.C.C.
Method: SOLUTION NMR Resolution: N.A.
Structural and functional characterisation of tst2, a novel trpv1 inhibitory peptide from the australian sea anemone telmatactis stephensoni
Elnahriry, K.A. , Norton, R.S. , Wai, D.C.C.
Primary Citation of Related Structures: 8SEM
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
TRPV1 inhibitory peptide Tst2 | A | 39 | Telmatactis Stephensoni | GCKGQDAPCSKSKDCCGEASMCSKGADGKKTCMIDKLWG |
Method: SOLUTION NMR
Deposited Date: 2023-04-10 Deposition Author(s): Elnahriry, K.A. , Norton, R.S. , Wai, D.C.C.