Solution structure of camp-dependent protein kinase rii-alpha subunit dimerization and docking domain complex with microtubule associated protein 2c (84-111)
PDB DOI: 10.2210/pdb8s8o/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica , Pandinus Imperator
Deposited: 2024-03-06 Deposition Author(s): Bartosik, V. , Janackova, Z. , Lanikova, A. , Padrta, P. , Zidek, L.
Solution structure of camp-dependent protein kinase rii-alpha subunit dimerization and docking domain complex with microtubule associated protein 2c (84-111)
Bartosik, V. , Janackova, Z. , Lanikova, A. , Padrta, P. , Zidek, L.
Primary Citation of Related Structures: 8S8O
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
cAMP-dependent protein kinase type II-alpha regulatory subunit | A | 52 | Salmonella Enterica , Pandinus Imperator | GAMGMSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPAS |
cAMP-dependent protein kinase type II-alpha regulatory subunit | B | 52 | Salmonella Enterica , Pandinus Imperator | GAMGMSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPAS |
Isoform 3 of Microtubule-associated protein 2 | C | 28 | Salmonella Enterica , Pandinus Imperator | RETAEEVSARIVQVVTAEAVAVLKGEQE |
Method: SOLUTION NMR
Deposited Date: 2024-03-06 Deposition Author(s): Bartosik, V. , Janackova, Z. , Lanikova, A. , Padrta, P. , Zidek, L.