Solution nmr structure of pacsin 2 sh3 domain
PDB DOI: 10.2210/pdb8rsw/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Gallus Gallus
Deposited: 2024-01-25 Deposition Author(s): Permi, P. , Tossavainen, H.
Solution nmr structure of pacsin 2 sh3 domain
Primary Citation of Related Structures: 8RSW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protein kinase C and casein kinase substrate in neurons protein 2 | A | 67 | Gallus Gallus | GSRRASVGSVRVRALYDYEGQEQDELSFKAGDELTKMENEDEQGWCKGRLDNGQVGLYPANYVEPIQ |
Method: SOLUTION NMR
Deposited Date: 2024-01-25 Deposition Author(s): Permi, P. , Tossavainen, H.