Solution structure of the antifungal protein nfap2
PDB DOI: 10.2210/pdb8rp9/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): Aspergillus Fischeri Nrrl 181
Deposited: 2024-01-13 Deposition Author(s): Ambrus, A. , Batta, G. , Czajlik, A. , Gai, J. , Galgoczy, L. , Toth, L.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the antifungal protein nfap2
Ambrus, A. , Batta, G. , Czajlik, A. , Gai, J. , Galgoczy, L. , Toth, L.
Primary Citation of Related Structures: 8RP9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Antifungal protein | A | 52 | Aspergillus Fischeri Nrrl 181 | IATSPYYACNCPNNCKHKKGSGCKYHSGPSDKSKVISGKCEWQGGQLNCIAT |
Method: SOLUTION NMR
Deposited Date: 2024-01-13 Deposition Author(s): Ambrus, A. , Batta, G. , Czajlik, A. , Gai, J. , Galgoczy, L. , Toth, L.