Structure of the znf domain from human roquin-1
PDB DOI: 10.2210/pdb8rhs/pdb
Classification: RNA BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2023-12-16 Deposition Author(s): Schlundt, A. , Tants, J.N.
Structure of the znf domain from human roquin-1
Primary Citation of Related Structures: 8RHS
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Roquin-1 | A | 48 | Homo Sapiens | GAMAHSKYKTYMCRDMKQRGGCPRGASCTFAHSQEELEKFRKMNKRLV |
Method: SOLUTION NMR
Deposited Date: 2023-12-16 Deposition Author(s): Schlundt, A. , Tants, J.N.