Solution structure of sulfazecin nrps holo-pcp domain 3
PDB DOI: 10.2210/pdb8rhm/pdb
Classification: TRANSFERASE Organism(s): Burkholderia Thailandensis E264
Deposited: 2023-12-15 Deposition Author(s): Chagot, B.
Solution structure of sulfazecin nrps holo-pcp domain 3
Primary Citation of Related Structures: 8RHM
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Non-ribosomal peptide synthetase, putative | A | 72 | Burkholderia Thailandensis E264 | GPGSRTPVELRLTEIFRDVLGHDAFGVLDDFFELGGDXFKAIRIAAKYGPPLEVTDIYDHPTIEALAAHLAR |
Method: SOLUTION NMR
Deposited Date: 2023-12-15 Deposition Author(s): Chagot, B.