Crystal structure of the c-terminal domain of chlamydomonas reinhardtii cfap410
PDB DOI: 10.2210/pdb8r9t/pdb
Classification: PROTEIN BINDING Organism(s): N.A.
Deposited: 2023-11-30 Deposition Author(s): Dong, G. , Stadler, A.
Crystal structure of the c-terminal domain of chlamydomonas reinhardtii cfap410
Primary Citation of Related Structures: 8R9T
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Flagellar associated protein | A | 35 | N.A. | STKNILYAVMALLGELEDEDLVYVRREIEQRIGGR |
Flagellar associated protein | B | 35 | N.A. | STKNILYAVMALLGELEDEDLVYVRREIEQRIGGR |
Flagellar associated protein | C | 35 | N.A. | STKNILYAVMALLGELEDEDLVYVRREIEQRIGGR |
Flagellar associated protein | D | 35 | N.A. | STKNILYAVMALLGELEDEDLVYVRREIEQRIGGR |
Method: X-RAY DIFFRACTION
Deposited Date: 2023-11-30 Deposition Author(s): Dong, G. , Stadler, A.