Nmr solution structure of thyropin irthy-cd from the hard tick ixodes ricinus
PDB DOI: 10.2210/pdb8r6t/pdb
Classification: PROTEIN BINDING Organism(s): Carboxydothermus Hydrogenoformans (Strain Atcc Baa-161 / Dsm 6008 / Z-2901)
Deposited: 2023-11-23 Deposition Author(s): Mares, M. , Matouskova, Z. , Orsaghova, K. , Srb, P. , Veverka, V.
Nmr solution structure of thyropin irthy-cd from the hard tick ixodes ricinus
Mares, M. , Matouskova, Z. , Orsaghova, K. , Srb, P. , Veverka, V.
Primary Citation of Related Structures: 8R6T
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Putative two thyropin protein (Fragment) | A | 72 | Carboxydothermus Hydrogenoformans (Strain Atcc Baa-161 / Dsm 6008 / Z-2901) | GAMGKCLAEHHEKSKSTHSQVGDDIPKCNLASGYYEQMQCNTQQHWCVDPESGTALGERRSGGCTEAARDHC |
Method: SOLUTION NMR
Deposited Date: 2023-11-23 Deposition Author(s): Mares, M. , Matouskova, Z. , Orsaghova, K. , Srb, P. , Veverka, V.