Dtx1 wwe domain in complex with adp bound to wwe2
PDB DOI: 10.2210/pdb8r6b/pdb
Classification: LIGASE Organism(s): Homo Sapiens
Deposited: 2023-11-21 Deposition Author(s): Boettcher, J. , Muenzker, L. , Zak, K.M.
Dtx1 wwe domain in complex with adp bound to wwe2
Boettcher, J. , Muenzker, L. , Zak, K.M.
Primary Citation of Related Structures: 8R6B
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| E3 ubiquitin-protein ligase DTX1 | A | 165 | Homo Sapiens | GNVARVVVWEWLNEHSRWRPYTATVCHHIENVLKEDARGSVVLGQVDAQLVPYIIDLQSMHQFRQDTGTMRPVRRNFYDPSSAPGKGIVWEWENDGGAWTAYDMDICITIQNAYEKQHPWLDLSSLGFCYLIYFNSMSQMNRQTRRRRRLRRRLDLAYPLTVGSI |
Method: X-RAY DIFFRACTION
Deposited Date: 2023-11-21 Deposition Author(s): Boettcher, J. , Muenzker, L. , Zak, K.M.