Solution structure and chemical shift assignments for hmg-d y12f mutant complexed to a 14:12 da2 bulge dna
PDB DOI: 10.2210/pdb8r1x/pdb
Classification: DNA BINDING PROTEIN Organism(s): Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2023-11-02 Deposition Author(s): Hill, G.R. , Neuhaus, D. , Yang, J.C.
Solution structure and chemical shift assignments for hmg-d y12f mutant complexed to a 14:12 da2 bulge dna
Hill, G.R. , Neuhaus, D. , Yang, J.C.
Primary Citation of Related Structures: 8R1X
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
High mobility group protein D | A | 112 | Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MSDKPKRPLSAFMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKSEWEAKAAKAKDDYDRAVKEFEANGGSSAANGGGAKKRAKPAKKVAKKSKKEESDEDDDDESE |
Method: SOLUTION NMR
Deposited Date: 2023-11-02 Deposition Author(s): Hill, G.R. , Neuhaus, D. , Yang, J.C.