Nf-yb/c heterodimer in complex with a 16-mer nf-ya-derived peptide stabilized with c8-hydrocarbon linker
PDB DOI: 10.2210/pdb8qu2/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2023-10-13 Deposition Author(s): Arbore, F. , Durukan, C. , Grossmann, T.N. , Hennig, S. , Klintrot, C.I.R.
Nf-yb/c heterodimer in complex with a 16-mer nf-ya-derived peptide stabilized with c8-hydrocarbon linker
Arbore, F. , Durukan, C. , Grossmann, T.N. , Hennig, S. , Klintrot, C.I.R.
Primary Citation of Related Structures: 8QU2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Nuclear transcription factor Y subunit alpha | A | 18 | Homo Sapiens , Synthetic Construct | XKQLHRILKRRQARAKLX |
| Nuclear transcription factor Y subunit beta | B | 95 | Homo Sapiens , Synthetic Construct | GPSFREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFRE |
| Nuclear transcription factor Y subunit gamma | C | 96 | Homo Sapiens , Synthetic Construct | GPMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR |
Method: X-RAY DIFFRACTION
Deposited Date: 2023-10-13 Deposition Author(s): Arbore, F. , Durukan, C. , Grossmann, T.N. , Hennig, S. , Klintrot, C.I.R.