Solution nmr structure of the peptidyl carrier domain tomapcp from the tomaymycin non-ribosomal peptide synthetase in its substrate-loaded state
PDB DOI: 10.2210/pdb8qrx/pdb
Classification: BIOSYNTHETIC PROTEIN Organism(s): Streptomyces Regensis
Deposited: 2023-10-09 Deposition Author(s): Carlomagno, T. , Karanth, M.N. , Kirkpatrick, J.P.
Solution nmr structure of the peptidyl carrier domain tomapcp from the tomaymycin non-ribosomal peptide synthetase in its substrate-loaded state
Carlomagno, T. , Karanth, M.N. , Kirkpatrick, J.P.
Primary Citation of Related Structures: 8QRX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| TomAPCP substrate-loaded from the Tomaymycin non-ribosomal peptide synthetase | A | 92 | Streptomyces Regensis | GPMATAVQNPLETVVLQAWKDISGADDFTTTDSFLGHGGNXLHFVQLASRLQKIFGVEVSTEDVFRHGTVEQLARFVEQSRDTGRNPAAQTQ |
Method: SOLUTION NMR
Deposited Date: 2023-10-09 Deposition Author(s): Carlomagno, T. , Karanth, M.N. , Kirkpatrick, J.P.